Lineage for d1nqna_ (1nqn A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806367Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 806368Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 806369Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 806370Protein Avidin [50880] (1 species)
  7. 806371Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)
  8. 806372Domain d1nqna_: 1nqn A: [86042]

Details for d1nqna_

PDB Entry: 1nqn (more details), 1.8 Å

PDB Description: structure of avm-w110k (w110k mutant of avidin)
PDB Compounds: (A:) Avidin

SCOP Domain Sequences for d1nqna_:

Sequence, based on SEQRES records: (download)

>d1nqna_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginift
rl

Sequence, based on observed residues (ATOM records): (download)

>d1nqna_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavneikesplhgtentinkrtqptfg
ftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddkkatrvginiftrl

SCOP Domain Coordinates for d1nqna_:

Click to download the PDB-style file with coordinates for d1nqna_.
(The format of our PDB-style files is described here.)

Timeline for d1nqna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nqnb_