Lineage for d1nqla4 (1nql A:481-614)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459803Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 1459804Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1459805Protein EGF receptor Cys-rich domains [82887] (1 species)
  7. 1459806Species Human (Homo sapiens) [TaxId:9606] [82888] (7 PDB entries)
  8. 1459825Domain d1nqla4: 1nql A:481-614 [86036]
    Other proteins in same PDB: d1nqla1, d1nqla2, d1nqlb_
    complexed with EGF
    complexed with nag

Details for d1nqla4

PDB Entry: 1nql (more details), 2.8 Å

PDB Description: Structure of the extracellular domain of human epidermal growth factor (EGF) receptor in an inactive (low pH) complex with EGF.
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1nqla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
vchalcspegcwgpeprdcvscrnvsrgrecvdkckllegeprefvenseciqchpeclp
qamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlchpnc
tygctgpglegcpt

SCOPe Domain Coordinates for d1nqla4:

Click to download the PDB-style file with coordinates for d1nqla4.
(The format of our PDB-style files is described here.)

Timeline for d1nqla4: