Lineage for d1nqdb1 (1nqd B:893-1008)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039933Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
    PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)
  6. 2039934Protein Class 1 collagenase [267633] (1 species)
  7. 2039935Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries)
  8. 2039943Domain d1nqdb1: 1nqd B:893-1008 [86026]
    Other proteins in same PDB: d1nqdb2
    complexed with ca

Details for d1nqdb1

PDB Entry: 1nqd (more details), 1.65 Å

PDB Description: crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.65 angstrom resolution in presence of calcium
PDB Compounds: (B:) class 1 collagenase

SCOPe Domain Sequences for d1nqdb1:

Sequence, based on SEQRES records: (download)

>d1nqdb1 b.18.1.36 (B:893-1008) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
gneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdef
gvtwtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

Sequence, based on observed residues (ATOM records): (download)

>d1nqdb1 b.18.1.36 (B:893-1008) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
gneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdef
gvtwtlhpesritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

SCOPe Domain Coordinates for d1nqdb1:

Click to download the PDB-style file with coordinates for d1nqdb1.
(The format of our PDB-style files is described here.)

Timeline for d1nqdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nqdb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1nqda_