SCOP 1.69: Domain d1nqaq1: 1nqa Q:0-148,Q:313-333

Lineage for d1nqaq1 (1nqa Q:0-148,Q:313-333)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (10 PDB entries)

8. Domain d1nqaq1: 1nqa Q:0-148,Q:313-333 [86020]
   Other proteins in same PDB: d1nqao2, d1nqap2, d1nqaq2, d1nqar2

Details for d1nqaq1

PDB Entry: 1nqa, 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ala complexed with nad+ and d-glyceraldehyde-3-phosphate

SCOP Domain Sequences for d1nqaq1:

Sequence; same for both SEQRES and ATOM records:

>d1nqaq1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

Timeline for d1nqaq1:

• d1nqaq1 first appeared in SCOP 1.65
  
• d1nqaq1 appears in SCOP 1.67
  
• d1nqaq1 appears in SCOP 1.71
  
• d1nqaq1 appears in the current release, SCOPe 2.08