Lineage for d1nqap1 (1nqa P:0-148,P:313-333)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308576Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
  7. 308588Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (10 PDB entries)
  8. 308606Domain d1nqap1: 1nqa P:0-148,P:313-333 [86018]
    Other proteins in same PDB: d1nqao2, d1nqap2, d1nqaq2, d1nqar2

Details for d1nqap1

PDB Entry: 1nqa (more details), 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ala complexed with nad+ and d-glyceraldehyde-3-phosphate

SCOP Domain Sequences for d1nqap1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqap1 c.2.1.3 (P:0-148,P:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d1nqap1:

Click to download the PDB-style file with coordinates for d1nqap1.
(The format of our PDB-style files is described here.)

Timeline for d1nqap1: