SCOP 1.65: Domain d1nq5c2: 1nq5 C:149-312

Lineage for d1nq5c2 (1nq5 C:149-312)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (3 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [55351] (10 PDB entries)

8. Domain d1nq5c2: 1nq5 C:149-312 [86011]
   Other proteins in same PDB: d1nq5a1, d1nq5c1, d1nq5o1, d1nq5q1

Details for d1nq5c2

PDB Entry: 1nq5, 2.11 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with cys 149 replaced by ser complexed with nad+

SCOP Domain Sequences for d1nq5c2:

Sequence; same for both SEQRES and ATOM records:

>d1nq5c2 d.81.1.1 (C:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
sttnclapfakvlheqfgivrgmmttvhsytndqrildlphkdlrraraaaesiiptttg
aakavalvlpelkgklngmamrvptpnvsvvdlvaelekevtveevnaalkaaaegelkg
ilayseeplvsrdyngstvsstidalstmvidgkmvkvvswyd

Timeline for d1nq5c2:

• d1nq5c2 is new in SCOP 1.65
  
• d1nq5c2 appears in SCOP 1.67
  
• d1nq5c2 appears in the current release, SCOPe 2.08