Lineage for d1npzb_ (1npz B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2533758Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2533866Protein (Pro)cathepsin S [82566] (1 species)
  7. 2533867Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)
  8. 2533904Domain d1npzb_: 1npz B: [86004]
    complexed with c1p

Details for d1npzb_

PDB Entry: 1npz (more details), 2 Å

PDB Description: crystal structures of cathepsin s inhibitor complexes
PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d1npzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npzb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvtlsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

SCOPe Domain Coordinates for d1npzb_:

Click to download the PDB-style file with coordinates for d1npzb_.
(The format of our PDB-style files is described here.)

Timeline for d1npzb_: