| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
| Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins) |
| Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species) |
| Species Aquifex aeolicus [TaxId:63363] [82074] (3 PDB entries) |
| Domain d1npra2: 1npr A:191-248 [85985] Other proteins in same PDB: d1npra1, d1npra3 |
PDB Entry: 1npr (more details), 2.21 Å
SCOPe Domain Sequences for d1npra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npra2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
skvefekgdqvrviegpfmnftgtveevhpekrkltvmisifgrmtpveldfdqveki
Timeline for d1npra2: