Lineage for d1npra2 (1npr A:191-248)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784286Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1784536Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins)
  6. 1784537Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species)
  7. 1784538Species Aquifex aeolicus [TaxId:63363] [82074] (3 PDB entries)
  8. 1784547Domain d1npra2: 1npr A:191-248 [85985]
    Other proteins in same PDB: d1npra1, d1npra3

Details for d1npra2

PDB Entry: 1npr (more details), 2.21 Å

PDB Description: crystal structure of aquifex aeolicus nusg in c222(1)
PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1npra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npra2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
skvefekgdqvrviegpfmnftgtveevhpekrkltvmisifgrmtpveldfdqveki

SCOPe Domain Coordinates for d1npra2:

Click to download the PDB-style file with coordinates for d1npra2.
(The format of our PDB-style files is described here.)

Timeline for d1npra2: