Lineage for d1npra1 (1npr A:51-131)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382650Fold b.114: N-utilization substance G protein NusG, insert domain [82003] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 382651Superfamily b.114.1: N-utilization substance G protein NusG, insert domain [82004] (1 family) (S)
  5. 382652Family b.114.1.1: N-utilization substance G protein NusG, insert domain [82005] (1 protein)
  6. 382653Protein N-utilization substance G protein NusG, insert domain [82006] (1 species)
    found only in some NusG species
  7. 382654Species Aquifex aeolicus [TaxId:63363] [82007] (4 PDB entries)
    interrupted by an insert beta-sandwich domain
  8. 382660Domain d1npra1: 1npr A:51-131 [85984]
    Other proteins in same PDB: d1npra2, d1npra3

Details for d1npra1

PDB Entry: 1npr (more details), 2.21 Å

PDB Description: crystal structure of aquifex aeolicus nusg in c222(1)

SCOP Domain Sequences for d1npra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npra1 b.114.1.1 (A:51-131) N-utilization substance G protein NusG, insert domain {Aquifex aeolicus}
eekvviraqgkekyrlslkgnardisvlgkkgvttfriengevkvvesvegdtcvnappi
skpgqkitckenkteakivld

SCOP Domain Coordinates for d1npra1:

Click to download the PDB-style file with coordinates for d1npra1.
(The format of our PDB-style files is described here.)

Timeline for d1npra1: