Lineage for d1nppd3 (1npp D:6-50,D:132-190)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911478Superfamily d.58.42: N-utilization substance G protein NusG, N-terminal domain [82679] (1 family) (S)
  5. 1911479Family d.58.42.1: N-utilization substance G protein NusG, N-terminal domain [82680] (1 protein)
  6. 1911480Protein N-utilization substance G protein NusG, N-terminal domain [82681] (3 species)
  7. 1911481Species Aquifex aeolicus [TaxId:63363] [82682] (4 PDB entries)
    interrupted by an insert beta-sandwich domain
  8. 1911486Domain d1nppd3: 1npp D:6-50,D:132-190 [85982]
    Other proteins in same PDB: d1nppa1, d1nppa2, d1nppb1, d1nppb2, d1nppc1, d1nppc2, d1nppd1, d1nppd2
    complexed with ipa

Details for d1nppd3

PDB Entry: 1npp (more details), 2 Å

PDB Description: crystal structure of aquifex aeolicus nusg in p2(1)
PDB Compounds: (D:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1nppd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nppd3 d.58.42.1 (D:6-50,D:132-190) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
vqelekkwyalqvepgkeneakenllkvleleglkdlvdevivpaXnkifpgyilikahm
ndkllmaiektphvfrpvmvggkpvplkeeevqnilnqikrgvkp

SCOPe Domain Coordinates for d1nppd3:

Click to download the PDB-style file with coordinates for d1nppd3.
(The format of our PDB-style files is described here.)

Timeline for d1nppd3: