Lineage for d1nppc2 (1npp C:191-247)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046659Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2046909Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 protein domains)
  6. 2046910Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species)
  7. 2046911Species Aquifex aeolicus [TaxId:63363] [82074] (3 PDB entries)
  8. 2046914Domain d1nppc2: 1npp C:191-247 [85978]
    Other proteins in same PDB: d1nppa1, d1nppa3, d1nppb1, d1nppb3, d1nppc1, d1nppc3, d1nppd1, d1nppd3
    complexed with ipa

Details for d1nppc2

PDB Entry: 1npp (more details), 2 Å

PDB Description: crystal structure of aquifex aeolicus nusg in p2(1)
PDB Compounds: (C:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1nppc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nppc2 b.34.5.4 (C:191-247) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
skvefekgdqvrviegpfmnftgtveevhpekrkltvmisifgrmtpveldfdqvek

SCOPe Domain Coordinates for d1nppc2:

Click to download the PDB-style file with coordinates for d1nppc2.
(The format of our PDB-style files is described here.)

Timeline for d1nppc2: