Class b: All beta proteins [48724] (165 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries) |
Domain d1npnb1: 1npn B:4-166 [85967] |
PDB Entry: 1npn (more details), 1.8 Å
SCOP Domain Sequences for d1npnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npnb1 b.6.1.3 (B:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgk
Timeline for d1npnb1:
View in 3D Domains from other chains: (mouse over for more information) d1npna1, d1npna2, d1npnc1, d1npnc2 |