Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419327] (31 PDB entries) Uniprot P38501 |
Domain d1npna2: 1npn A:167-339 [85966] Other proteins in same PDB: d1npna1, d1npnb1, d1npnc1 complexed with cl, cu; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1npn (more details), 1.8 Å
SCOPe Domain Sequences for d1npna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npna2 b.6.1.3 (A:167-339) Nitrite reductase, NIR, C-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d1npna2:
View in 3D Domains from other chains: (mouse over for more information) d1npnb1, d1npnb2, d1npnc1, d1npnc2 |