SCOP 1.65: Domain d1npjb2: 1npj B:167-339

Lineage for d1npjb2 (1npj B:167-339)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (6 proteins)

6. Protein Nitrite reductase, NIR [49551] (4 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (21 PDB entries)

8. Domain d1npjb2: 1npj B:167-339 [85962]

Details for d1npjb2

PDB Entry: 1npj, 1.9 Å

PDB Description: crystal structure of h145a mutant of nitrite reductase from alcaligenes faecalis

SCOP Domain Sequences for d1npjb2:

Sequence; same for both SEQRES and ATOM records:

>d1npjb2 b.6.1.3 (B:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d1npjb2:

• d1npjb2 is new in SCOP 1.65
  
• d1npjb2 appears in SCOP 1.67
  
• d1npjb2 appears in the current release, SCOPe 2.08