Lineage for d1np6a_ (1np6 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394266Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 394398Protein Molybdopterin-guanine dinucleotide biosynthesis protein MobB [89673] (1 species)
    forms segment-swapped dimer
  7. 394399Species Escherichia coli [TaxId:562] [89674] (2 PDB entries)
  8. 394400Domain d1np6a_: 1np6 A: [85954]

Details for d1np6a_

PDB Entry: 1np6 (more details), 1.9 Å

PDB Description: crystal structure of escherichia coli mobb

SCOP Domain Sequences for d1np6a_:

Sequence, based on SEQRES records: (download)

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli}
mipllafaawsgtgkttllkklipalcargirpglikhthhdmdvdkpgkdsyelrkaga
aqtivasqqrwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdga
ghrpeelvidrhviavasdvplnldvalldindvegladfvvewmqkqng

Sequence, based on observed residues (ATOM records): (download)

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli}
mipllafaawsgtgkttllkklipalcargirpglikhthhelrkagaaqtivasqqrwa
lmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdgaghrpeelvidrh
viavasdvplnldvalldindvegladfvvewmqkqng

SCOP Domain Coordinates for d1np6a_:

Click to download the PDB-style file with coordinates for d1np6a_.
(The format of our PDB-style files is described here.)

Timeline for d1np6a_: