SCOPe 2.06: Domain d1np3d2: 1np3 D:1-182

Lineage for d1np3d2 (1np3 D:1-182)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Class I ketol-acid reductoisomerase (KARI) [89532] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [89533] (1 PDB entry)

8. Domain d1np3d2: 1np3 D:1-182 [85953]
   Other proteins in same PDB: d1np3a1, d1np3b1, d1np3c1, d1np3d1

Details for d1np3d2

PDB Entry: 1np3, 2 Å

PDB Description: Crystal structure of class I acetohydroxy acid isomeroreductase from Pseudomonas aeruginosa

PDB Compounds: (D:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d1np3d2:

Sequence; same for both SEQRES and ATOM records:

>d1np3d2 c.2.1.6 (D:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]}
mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg
lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra
dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie
tt

Timeline for d1np3d2:

• d1np3d2 first appeared in SCOP 1.65
  
• d1np3d2 appears in SCOPe 2.05
  
• d1np3d2 appears in SCOPe 2.07
  
• d1np3d2 appears in the current release, SCOPe 2.08