![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Class I ketol-acid reductoisomerase (KARI) [89532] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [89533] (1 PDB entry) |
![]() | Domain d1np3d2: 1np3 D:1-182 [85953] Other proteins in same PDB: d1np3a1, d1np3b1, d1np3c1, d1np3d1 |
PDB Entry: 1np3 (more details), 2 Å
SCOP Domain Sequences for d1np3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1np3d2 c.2.1.6 (D:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} mrvfydkdcdlsiiqgkkvaiigygsqghahacnlkdsgvdvtvglrsgsatvakaeahg lkvadvktavaaadvvmiltpdefqgrlykeeiepnlkkgatlafahgfsihynqvvpra dldvimiapkapghtvrsefvkgggipdliaiyqdasgnaknvalsyacgvgggrtgiie tt
Timeline for d1np3d2: