Lineage for d1np3a1 (1np3 A:183-327)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006510Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)
  6. 2006511Protein Class I ketol-acid reductoisomerase [89101] (1 species)
  7. 2006512Species Pseudomonas aeruginosa [TaxId:287] [89102] (1 PDB entry)
  8. 2006513Domain d1np3a1: 1np3 A:183-327 [85946]
    Other proteins in same PDB: d1np3a2, d1np3b2, d1np3c2, d1np3d2

Details for d1np3a1

PDB Entry: 1np3 (more details), 2 Å

PDB Description: Crystal structure of class I acetohydroxy acid isomeroreductase from Pseudomonas aeruginosa
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d1np3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np3a1 a.100.1.2 (A:183-327) Class I ketol-acid reductoisomerase {Pseudomonas aeruginosa [TaxId: 287]}
fkdetetdlfgeqavlcggcvelvkagfetlveagyapemayfeclhelklivdlmyegg
ianmnysisnnaeygeyvtgpevinaesraamrnalkriqdgeyakmfitegaanypsmt
ayrrnnaahpieqigeklrammpwi

SCOPe Domain Coordinates for d1np3a1:

Click to download the PDB-style file with coordinates for d1np3a1.
(The format of our PDB-style files is described here.)

Timeline for d1np3a1: