Lineage for d1np2b_ (1np2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082981Species Thermus nonproteolyticus [TaxId:116039] [89477] (1 PDB entry)
  8. 2082983Domain d1np2b_: 1np2 B: [85945]

Details for d1np2b_

PDB Entry: 1np2 (more details), 2.4 Å

PDB Description: Crystal structure of thermostable beta-glycosidase from thermophilic eubacterium Thermus nonproteolyticus HG102
PDB Compounds: (B:) beta-glycosidase

SCOPe Domain Sequences for d1np2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1np2b_ c.1.8.4 (B:) Beta-glucosidase A {Thermus nonproteolyticus [TaxId: 116039]}
aekflwgvatsayqiegatqedgrgpsiwdtfarrpgairdgstgepacdhyhryeedia
lmqslgvgvyrfsvawprilpegrgrinpkglafydrlvdrllaagitpfltlyhwdlpq
aledrggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrn
leaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnryfld
pilgrgypespfqdpppapilsrdleaiarpldflgvnyyapvrvapgtgplpvrylppe
gpvtamgwevypeglyhllkrlgrevpwplyitengaaypdlwtgeavvedpervaylea
hveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrripkrsalwyre
riaraq

SCOPe Domain Coordinates for d1np2b_:

Click to download the PDB-style file with coordinates for d1np2b_.
(The format of our PDB-style files is described here.)

Timeline for d1np2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1np2a_