Lineage for d1np0a1 (1np0 A:200-552)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083407Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 protein domains)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2083424Protein beta-hexosaminidase B [89486] (1 species)
  7. 2083425Species Human (Homo sapiens) [TaxId:9606] [89487] (6 PDB entries)
  8. 2083436Domain d1np0a1: 1np0 A:200-552 [85940]
    Other proteins in same PDB: d1np0a2, d1np0b2
    complexed with gol, ngt, so4

Details for d1np0a1

PDB Entry: 1np0 (more details), 2.5 Å

PDB Description: human lysosomal beta-hexosaminidase isoform b in complex with intermediate analogue nag-thiazoline
PDB Compounds: (A:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d1np0a1:

Sequence, based on SEQRES records: (download)

>d1np0a1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysrqnkldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

Sequence, based on observed residues (ATOM records): (download)

>d1np0a1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysldsfgpin
ptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtdfkkl
esfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtasgfpv
ilsapwyldlisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnltprlw
prasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

SCOPe Domain Coordinates for d1np0a1:

Click to download the PDB-style file with coordinates for d1np0a1.
(The format of our PDB-style files is described here.)

Timeline for d1np0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1np0a2