Lineage for d1nowb2 (1now B:55-199)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729626Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 729627Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (3 proteins)
    family GH20
  6. 729634Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 729635Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
  8. 729637Domain d1nowb2: 1now B:55-199 [85939]
    Other proteins in same PDB: d1nowa1, d1nowb1
    complexed with gol, ifg, nag, so4

Details for d1nowb2

PDB Entry: 1now (more details), 2.2 Å

PDB Description: human lysosomal beta-hexosaminidase isoform b in complex with (2r,3r, 4s,5r)-2-acetamido-3,4-dihydroxy-5-hydroxymethyl-piperidinium chloride (galnac-isofagomine)
PDB Compounds: (B:) beta-hexosaminidase beta chain

SCOP Domain Sequences for d1nowb2:

Sequence, based on SEQRES records: (download)

>d1nowb2 d.92.2.1 (B:55-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhhe
paefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrglet
fsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d1nowb2 d.92.2.1 (B:55-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
alwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqqll
vsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtft
inestiidspr

SCOP Domain Coordinates for d1nowb2:

Click to download the PDB-style file with coordinates for d1nowb2.
(The format of our PDB-style files is described here.)

Timeline for d1nowb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nowb1