Lineage for d1noga_ (1nog A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 280081Superfamily a.25.2: Thermoplasma ferritin-like 4-helical bundle [89028] (2 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 280086Family a.25.2.2: Hypothetical protein Ta0546 [89032] (1 protein)
  6. 280087Protein Hypothetical protein Ta0546 [89033] (1 species)
  7. 280088Species Archaeon Thermoplasma acidophilum [TaxId:2303] [89034] (1 PDB entry)
  8. 280089Domain d1noga_: 1nog A: [85923]
    structural genomics

Details for d1noga_

PDB Entry: 1nog (more details), 1.55 Å

PDB Description: Crystal Structure of Conserved Protein 0546 from Thermoplasma Acidophilum

SCOP Domain Sequences for d1noga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1noga_ a.25.2.2 (A:) Hypothetical protein Ta0546 {Archaeon Thermoplasma acidophilum}
spvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedvstggkgrtvtrem
idylearvkemkaeigkielfvvpggsvesaslhmaravsrrlerrivaasklteinknv
liyanrlssilfmhalisnkrlnipekiw

SCOP Domain Coordinates for d1noga_:

Click to download the PDB-style file with coordinates for d1noga_.
(The format of our PDB-style files is described here.)

Timeline for d1noga_: