SCOP 1.75: Domain d1nni1_: 1nni 1:

Lineage for d1nni1_ (1nni 1:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.4: NADPH-dependent FMN reductase [89590] (4 proteins)
   Pfam PF03358

6. Protein Azobenzene reductase [89591] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89592] (2 PDB entries)
   YhdA gene product

8. Domain d1nni1_: 1nni 1: [85904]
   structural genomics
   complexed with fmn, mse

Details for d1nni1_

PDB Entry: 1nni, 2.5 Å

PDB Description: Azobenzene Reductase from Bacillus subtilis

PDB Compounds: (1:) hypothetical protein yhda

SCOP Domain Sequences for d1nni1_:

Sequence; same for both SEQRES and ATOM records:

>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]}
mnmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqr
vtkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrt
vmrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagn

Timeline for d1nni1_:

• d1nni1_ first appeared in SCOP 1.65
  
• d1nni1_ appears in SCOP 1.73
  
• d1nni1_ appears in SCOPe 2.01
  
• d1nni1_ appears in the current release, SCOPe 2.08, called d1nni11