Lineage for d1nni11 (1nni 1:2-171)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102693Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 protein domains)
    Pfam PF03358
  6. 2102694Protein Azobenzene reductase [89591] (2 species)
  7. 2102695Species Bacillus subtilis [TaxId:1423] [89592] (1 PDB entry)
    YhdA gene product
  8. 2102696Domain d1nni11: 1nni 1:2-171 [85904]
    Other proteins in same PDB: d1nni12
    structural genomics
    complexed with fmn

Details for d1nni11

PDB Entry: 1nni (more details), 2.5 Å

PDB Description: Azobenzene Reductase from Bacillus subtilis
PDB Compounds: (1:) hypothetical protein yhda

SCOPe Domain Sequences for d1nni11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nni11 c.23.5.4 (1:2-171) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]}
nmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrv
tkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtv
mrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagn

SCOPe Domain Coordinates for d1nni11:

Click to download the PDB-style file with coordinates for d1nni11.
(The format of our PDB-style files is described here.)

Timeline for d1nni11:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nni12