SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1nni11 (1nni 1:2-171)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102693Family c.23.5.4: NADPH-dependent FMN reductase [89590] (5 protein domains)
    Pfam PF03358
  6. 2102694Protein Azobenzene reductase [89591] (2 species)
  7. 2102695Species Bacillus subtilis [TaxId:1423] [89592] (1 PDB entry)
    YhdA gene product
  8. 2102696Domain d1nni11: 1nni 1:2-171 [85904]
    Other proteins in same PDB: d1nni12
    structural genomics
    complexed with fmn

Details for d1nni11

PDB Entry: 1nni (more details), 2.5 Å

PDB Description: Azobenzene Reductase from Bacillus subtilis
PDB Compounds: (1:) hypothetical protein yhda

SCOPe Domain Sequences for d1nni11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nni11 c.23.5.4 (1:2-171) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]}
nmlvingtprkhgrtriaasyiaalyhtdlidlsefvlpvfngeaeqsellkvqelkqrv
tkadaivllspeyhsgmsgalknaldflsseqfkykpvallavagggkgginalnnmrtv
mrgvyanvipkqlvldpvhidvenatvaenikesikelveelsmfakagn

SCOPe Domain Coordinates for d1nni11:

Click to download the PDB-style file with coordinates for d1nni11.
(The format of our PDB-style files is described here.)

Timeline for d1nni11:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nni12