SCOPe 2.05: Domain d1nnfa_: 1nnf A:

Lineage for d1nnfa_ (1nnf A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Ferric-binding protein FbpA [53867] (7 species)

7. Species Haemophilus influenzae [TaxId:727] [53868] (12 PDB entries)

8. Domain d1nnfa_: 1nnf A: [85903]
   complexed with edt, fe; mutant

Details for d1nnfa_

PDB Entry: 1nnf, 1.1 Å

PDB Description: crystal structure analysis of haemophlius influenzae ferric-ion binding protein h9q mutant form

PDB Compounds: (A:) Iron-utilization periplasmic protein

SCOPe Domain Sequences for d1nnfa_:

Sequence; same for both SEQRES and ATOM records:

>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]}
ditvyngqqkeaatavakafeqetgikvtlnsgkseqlagqlkeegdktpadvfyteqta
tfadlseagllapiseqtiqqtaqkgvplapkkdwialsgrsrvvvydhtklsekdmeks
vldyatpkwkgkigyvstsgafleqvvalskmkgdkvalnwlkglkengklyaknsvalq
avengevpaalinnyywynlakekgvenlksrlyfvrhqdpgalvsysgaavlkasknqa
eaqkfvdflaskkgqealvaaraeyplradvvspfnlepyekleapvvsattaqdkehai
klieeagl

Timeline for d1nnfa_:

• d1nnfa_ first appeared in SCOP 1.65
  
• d1nnfa_ appears in SCOPe 2.04
  
• d1nnfa_ appears in SCOPe 2.06
  
• d1nnfa_ appears in the current release, SCOPe 2.08