Lineage for d1nnea4 (1nne A:1-120)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506361Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 506384Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 506385Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 506386Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 506402Species Thermus aquaticus [TaxId:271] [55274] (3 PDB entries)
  8. 506407Domain d1nnea4: 1nne A:1-120 [85898]
    Other proteins in same PDB: d1nnea1, d1nnea2, d1nnea3, d1nneb1, d1nneb2, d1nneb3

Details for d1nnea4

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex

SCOP Domain Sequences for d1nnea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnea4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus}
megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt

SCOP Domain Coordinates for d1nnea4:

Click to download the PDB-style file with coordinates for d1nnea4.
(The format of our PDB-style files is described here.)

Timeline for d1nnea4: