Lineage for d1nnea1 (1nne A:267-541)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447287Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 447288Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 447289Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 447290Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 447306Species Thermus aquaticus [TaxId:271] [48337] (4 PDB entries)
  8. 447311Domain d1nnea1: 1nne A:267-541 [85895]
    Other proteins in same PDB: d1nnea2, d1nnea3, d1nnea4, d1nneb2, d1nneb3, d1nneb4

Details for d1nnea1

PDB Entry: 1nne (more details), 3.11 Å

PDB Description: Crystal Structure of the MutS-ADPBeF3-DNA complex

SCOP Domain Sequences for d1nnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnea1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus}
rgqdtlfsvldetrtapgrrllqswlrhplldrgplearldrvegfvregalregvrrll
yrladlerlatrlelgraspkdlgalrrslqilpelrallgeevglpdlsplkeeleaal
vedpplkvseggliregydpdldalraahregvayfleleererertgiptlkvgynavf
gyylevtrpyyervpkeyrpvqtlkdrqrytlpemkekerevyrlealirrreeevflev
rerakrqaealreaarilaeldvyaalaevavryg

SCOP Domain Coordinates for d1nnea1:

Click to download the PDB-style file with coordinates for d1nnea1.
(The format of our PDB-style files is described here.)

Timeline for d1nnea1: