Lineage for d1nn7a_ (1nn7 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410976Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 410977Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 411020Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins)
  6. 411049Protein Potassium channel kv4.2 [89908] (1 species)
  7. 411050Species Rat (Rattus norvegicus) [TaxId:10116] [89909] (1 PDB entry)
  8. 411051Domain d1nn7a_: 1nn7 A: [85894]
    complexed with zn

Details for d1nn7a_

PDB Entry: 1nn7 (more details), 2.1 Å

PDB Description: crystal structure of the tetramerization domain of the shal voltage- gated potassium channel

SCOP Domain Sequences for d1nn7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus)}
livlnvsgtrfqtwqdtlerypdtllgsserdffyhpetqqyffdrdpdifrhilnfyrt
gklhyprhecisaydeelaffglipeiigdccyeeykdrrrenae

SCOP Domain Coordinates for d1nn7a_:

Click to download the PDB-style file with coordinates for d1nn7a_.
(The format of our PDB-style files is described here.)

Timeline for d1nn7a_: