Lineage for d1nn7a_ (1nn7 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513512Family d.42.1.2: Tetramerization domain of potassium channels [54701] (7 protein domains)
  6. 2513541Protein Potassium channel kv4.2 [89908] (1 species)
  7. 2513542Species Norway rat (Rattus norvegicus) [TaxId:10116] [89909] (1 PDB entry)
  8. 2513543Domain d1nn7a_: 1nn7 A: [85894]
    complexed with zn

Details for d1nn7a_

PDB Entry: 1nn7 (more details), 2.1 Å

PDB Description: crystal structure of the tetramerization domain of the shal voltage- gated potassium channel
PDB Compounds: (A:) potassium channel Kv4.2

SCOPe Domain Sequences for d1nn7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
livlnvsgtrfqtwqdtlerypdtllgsserdffyhpetqqyffdrdpdifrhilnfyrt
gklhyprhecisaydeelaffglipeiigdccyeeykdrrrenae

SCOPe Domain Coordinates for d1nn7a_:

Click to download the PDB-style file with coordinates for d1nn7a_.
(The format of our PDB-style files is described here.)

Timeline for d1nn7a_: