Lineage for d1nmya_ (1nmy A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109670Protein Thymidylate kinase [52563] (4 species)
  7. 2109687Species Human (Homo sapiens) [TaxId:9606] [64010] (20 PDB entries)
  8. 2109690Domain d1nmya_: 1nmy A: [85883]
    complexed with adp, anp, fdm, mg

Details for d1nmya_

PDB Entry: 1nmy (more details), 1.6 Å

PDB Description: crystal structure of human thymidylate kinase with fltmp and appnhp
PDB Compounds: (A:) similar to THYMIDYLATE KINASE (DTMP KINASE)

SCOPe Domain Sequences for d1nmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmya_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}
rrgalivlegvdragkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgafgheryengafqeralrcfhqlmkdttlnwkmvdasks
ieavhedirvlsedaiatatekplgelwk

SCOPe Domain Coordinates for d1nmya_:

Click to download the PDB-style file with coordinates for d1nmya_.
(The format of our PDB-style files is described here.)

Timeline for d1nmya_: