Lineage for d1nmqb_ (1nmq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2100993Protein Apopain (caspase-3, cpp32) [52131] (1 species)
  7. 2100994Species Human (Homo sapiens) [TaxId:9606] [52132] (28 PDB entries)
  8. 2101025Domain d1nmqb_: 1nmq B: [85878]
    complexed with 160

Details for d1nmqb_

PDB Entry: 1nmq (more details), 2.4 Å

PDB Description: Extendend Tethering: In Situ Assembly of Inhibitors
PDB Compounds: (B:) Caspase-3

SCOPe Domain Sequences for d1nmqb_:

Sequence, based on SEQRES records: (download)

>d1nmqb_ c.17.1.1 (B:) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgietdsgvdddmachkipvdadflyaystapgyyswrnskdgs
wfiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkel
yfyh

Sequence, based on observed residues (ATOM records): (download)

>d1nmqb_ c.17.1.1 (B:) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgietdddchkipvdadflyaystapgyyswrnskdgswfiqsl
camlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh

SCOPe Domain Coordinates for d1nmqb_:

Click to download the PDB-style file with coordinates for d1nmqb_.
(The format of our PDB-style files is described here.)

Timeline for d1nmqb_: