Lineage for d1nm8a1 (1nm8 A:14-385)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482501Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2482502Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2482604Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
    Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 2482605Protein Carnitine acetyltransferase [82425] (2 species)
    relative spatial position of the domains is similar to the monomers in CAT trimer
  7. 2482606Species Human (Homo sapiens) [TaxId:9606] [89697] (2 PDB entries)
  8. 2482607Domain d1nm8a1: 1nm8 A:14-385 [85872]
    Other proteins in same PDB: d1nm8a3

Details for d1nm8a1

PDB Entry: 1nm8 (more details), 1.6 Å

PDB Description: Structure of Human Carnitine Acetyltransferase: Molecular Basis for Fatty Acyl Transfer
PDB Compounds: (A:) Carnitine O-acetyltransferase

SCOPe Domain Sequences for d1nm8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm8a1 c.43.1.3 (A:14-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
lprlpvpplqqsldhylkalqpivseeewahtkqlvdefqasggvgerlqkglerrarkt
enwlsewwlktaylqyrqpvviysspgvmlpkqdfvdlqgqlrfaakliegvldfkvmid
netlpveylggkplcmnqyyqilsscrvpgpkqdtvsnfsktkkppthitvvhnyqffel
dvyhsdgtpltadqifvqlekiwnsslqtnkepvgiltsnhrnswakayntlikdkvnrd
svrsiqksiftvcldatmprvsedvyrshvagqmlhgggsrlnsgnrwfdktlqfivaed
gscglvyehaaaegppivtlldyvieytkkpelvrspmvplpmpkklrfnitpeiksdie
kakqnlsimiqd

SCOPe Domain Coordinates for d1nm8a1:

Click to download the PDB-style file with coordinates for d1nm8a1.
(The format of our PDB-style files is described here.)

Timeline for d1nm8a1: