SCOPe 2.05: Domain d1nm8a1: 1nm8 A:9-385

Lineage for d1nm8a1 (1nm8 A:9-385)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Carnitine acetyltransferase [82425] (2 species)
   relative spatial position of the domains is similar to the monomers in CAT trimer

7. Species Human (Homo sapiens) [TaxId:9606] [89697] (2 PDB entries)

8. Domain d1nm8a1: 1nm8 A:9-385 [85872]

Details for d1nm8a1

PDB Entry: 1nm8, 1.6 Å

PDB Description: Structure of Human Carnitine Acetyltransferase: Molecular Basis for Fatty Acyl Transfer

PDB Compounds: (A:) Carnitine O-acetyltransferase

SCOPe Domain Sequences for d1nm8a1:

Sequence; same for both SEQRES and ATOM records:

>d1nm8a1 c.43.1.3 (A:9-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
hhtdplprlpvpplqqsldhylkalqpivseeewahtkqlvdefqasggvgerlqkgler
rarktenwlsewwlktaylqyrqpvviysspgvmlpkqdfvdlqgqlrfaakliegvldf
kvmidnetlpveylggkplcmnqyyqilsscrvpgpkqdtvsnfsktkkppthitvvhny
qffeldvyhsdgtpltadqifvqlekiwnsslqtnkepvgiltsnhrnswakayntlikd
kvnrdsvrsiqksiftvcldatmprvsedvyrshvagqmlhgggsrlnsgnrwfdktlqf
ivaedgscglvyehaaaegppivtlldyvieytkkpelvrspmvplpmpkklrfnitpei
ksdiekakqnlsimiqd

Timeline for d1nm8a1:

• d1nm8a1 first appeared in SCOP 1.65
  
• d1nm8a1 appears in SCOPe 2.04
  
• d1nm8a1 appears in SCOPe 2.06
  
• d1nm8a1 appears in the current release, SCOPe 2.08