Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) |
Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
Protein Carnitine acetyltransferase [82425] (2 species) relative spatial position of the domains is similar to the monomers in CAT trimer |
Species Human (Homo sapiens) [TaxId:9606] [89697] (2 PDB entries) |
Domain d1nm8a1: 1nm8 A:9-385 [85872] |
PDB Entry: 1nm8 (more details), 1.6 Å
SCOPe Domain Sequences for d1nm8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nm8a1 c.43.1.3 (A:9-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} hhtdplprlpvpplqqsldhylkalqpivseeewahtkqlvdefqasggvgerlqkgler rarktenwlsewwlktaylqyrqpvviysspgvmlpkqdfvdlqgqlrfaakliegvldf kvmidnetlpveylggkplcmnqyyqilsscrvpgpkqdtvsnfsktkkppthitvvhny qffeldvyhsdgtpltadqifvqlekiwnsslqtnkepvgiltsnhrnswakayntlikd kvnrdsvrsiqksiftvcldatmprvsedvyrshvagqmlhgggsrlnsgnrwfdktlqf ivaedgscglvyehaaaegppivtlldyvieytkkpelvrspmvplpmpkklrfnitpei ksdiekakqnlsimiqd
Timeline for d1nm8a1: