Lineage for d1nm3a2 (1nm3 A:3-165)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853647Protein N-terminal, Prx domain of Hybrid-Prx5 [89708] (1 species)
  7. 1853648Species Haemophilus influenzae [TaxId:727] [89709] (1 PDB entry)
    HI0572
  8. 1853649Domain d1nm3a2: 1nm3 A:3-165 [85867]
    Other proteins in same PDB: d1nm3a1, d1nm3b1
    complexed with so4

Details for d1nm3a2

PDB Entry: 1nm3 (more details), 2.8 Å

PDB Description: Crystal structure of Heamophilus influenza hybrid-Prx5
PDB Compounds: (A:) Protein HI0572

SCOPe Domain Sequences for d1nm3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nm3a2 c.47.1.10 (A:3-165) N-terminal, Prx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]}
smegkkvpqvtfrtrqgdkwvdvttselfdnktvivfslpgaftptcssshlprynelap
vfkkygvddilvvsvndtfvmnawkedeksenisfipdgngeftegmgmlvgkedlgfgk
rswrysmlvkngvvekmfiepnepgdpfkvsdadtmlkylapq

SCOPe Domain Coordinates for d1nm3a2:

Click to download the PDB-style file with coordinates for d1nm3a2.
(The format of our PDB-style files is described here.)

Timeline for d1nm3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nm3a1