SCOPe 2.06: Domain d1nlze_: 1nlz E:

Lineage for d1nlze_ (1nlz E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Hexameric traffic ATPase, HP0525 [52719] (1 species)
   type II/IV secretion system protein; includes N-terminal alpha+beta domain of a profilin-like topology

7. Species Helicobacter pylori [TaxId:210] [52720] (5 PDB entries)

8. Domain d1nlze_: 1nlz E: [85864]

Details for d1nlze_

PDB Entry: 1nlz, 3 Å

PDB Description: Crystal structure of unliganded traffic ATPase of the type IV secretion system of helicobacter pylori

PDB Compounds: (E:) virB11 homolog

SCOPe Domain Sequences for d1nlze_:

Sequence; same for both SEQRES and ATOM records:

>d1nlze_ c.37.1.11 (E:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}
alnplrhateelfgdflkmeniteicyngnkvvwvlknngewqpfdvrdrkafslsrlmh
farccasfkkktidnyenpilssnlangervqivlspvtvndetisisiripskttyphs
ffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkttyiksimefipkeeriis
iedteeivfkhhknytqlffggnitsadclksclrmrpdriilgelrsseaydfynvlcs
ghkgtlttlhagsseeafirlanmsssnsaarnikfesliegfkdlidmivhinhhkqcd
efyik

Timeline for d1nlze_:

• d1nlze_ first appeared in SCOP 1.65
  
• d1nlze_ appears in SCOPe 2.05
  
• d1nlze_ appears in SCOPe 2.07
  
• d1nlze_ appears in the current release, SCOPe 2.08