SCOP 1.71: Domain d1nlqa_: 1nlq A:

Lineage for d1nlqa_ (1nlq A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family)
   oligomerizes into a pentameric ring structure

5. Family b.121.3.1: Nucleoplasmin-like core domain [69204] (3 proteins)

6. Protein Chromatin decondensation protein 1 (Crp1, Nlp) [89223] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89224] (1 PDB entry)

8. Domain d1nlqa_: 1nlq A: [85853]

Details for d1nlqa_

PDB Entry: 1nlq, 1.5 Å

PDB Description: The crystal structure of Drosophila NLP-core provides insight into pentamer formation and histone binding

SCOP Domain Sequences for d1nlqa_:

Sequence; same for both SEQRES and ATOM records:

>d1nlqa_ b.121.3.1 (A:) Chromatin decondensation protein 1 (Crp1, Nlp) {Fruit fly (Drosophila melanogaster)}
eesfygvtltaesdsvtwdvdedyargqklvikqillgaeakenefnvvevntpkdsvqi
piavlkagetravnpdvefyeskvtfklikgsgpvyihghnikdd

Timeline for d1nlqa_:

• d1nlqa_ first appeared in SCOP 1.65
  
• d1nlqa_ appears in SCOP 1.69
  
• d1nlqa_ appears in SCOP 1.73
  
• d1nlqa_ appears in the current release, SCOPe 2.08