Lineage for d1nlfc_ (1nlf C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112502Protein Hexameric replicative helicase repA [52676] (1 species)
  7. 2112503Species Escherichia coli [TaxId:562] [52677] (3 PDB entries)
  8. 2112506Domain d1nlfc_: 1nlf C: [85852]
    protein/DNA complex; complexed with so4

Details for d1nlfc_

PDB Entry: 1nlf (more details), 1.95 Å

PDB Description: crystal structure of dna helicase repa in complex with sulfate at 1.95 a resolution
PDB Compounds: (C:) regulatory protein repa

SCOPe Domain Sequences for d1nlfc_:

Sequence, based on SEQRES records: (download)

>d1nlfc_ c.37.1.11 (C:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}
athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas
kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska
nygapfadrwfrrhdggvlkpavlerqrkskgvp

Sequence, based on observed residues (ATOM records): (download)

>d1nlfc_ c.37.1.11 (C:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}
athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll
evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap
ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav
lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk
pavlerqrkskgvp

SCOPe Domain Coordinates for d1nlfc_:

Click to download the PDB-style file with coordinates for d1nlfc_.
(The format of our PDB-style files is described here.)

Timeline for d1nlfc_: