Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Hexameric replicative helicase repA [52676] (1 species) |
Species Escherichia coli [TaxId:562] [52677] (2 PDB entries) |
Domain d1nlfb_: 1nlf B: [85851] |
PDB Entry: 1nlf (more details), 1.95 Å
SCOP Domain Sequences for d1nlfb_:
Sequence, based on SEQRES records: (download)
>d1nlfb_ c.37.1.11 (B:) Hexameric replicative helicase repA {Escherichia coli} athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhas kgaammgagdqqqasrgssvlvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvska nygapfadrwfrrhdggvlkpavlerqrkskgvp
>d1nlfb_ c.37.1.11 (B:) Hexameric replicative helicase repA {Escherichia coli} athkpinileafaaapppldyvlpnmvagtvgalvspggagksmlalqlaaqiaggpdll evgelptgpviylpaedpptaihhrlhalgahlsaeerqavadglliqpligslpnimap ewfdglkraaegrrlmvldtlrrfhieeenasgpmaqvigrmeaiaadtgcsivflhhav lvdnirwqsylssmtsaeaeewgvdddqrrffvrfgvskanygapfadrwfrrhdggvlk pavlerqrkskgvp
Timeline for d1nlfb_: