Lineage for d1nl3b4 (1nl3 B:397-615)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394893Family c.37.1.19: Tandem AAA-ATPase domain [81268] (9 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 394955Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (2 species)
    a pre-protein crosslinking domain inserted in the first AAA domain
  7. 394961Species Mycobacterium tuberculosis [TaxId:1773] [89687] (2 PDB entries)
  8. 394969Domain d1nl3b4: 1nl3 B:397-615 [85846]
    Other proteins in same PDB: d1nl3a1, d1nl3a2, d1nl3b1, d1nl3b2

Details for d1nl3b4

PDB Entry: 1nl3 (more details), 2.8 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis in apo form

SCOP Domain Sequences for d1nl3b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl3b4 c.37.1.19 (B:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis}
mpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrrip
hnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpv
etpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgd
pgesrfylslgdelmrrfngaaletlltrlnlpddvpie

SCOP Domain Coordinates for d1nl3b4:

Click to download the PDB-style file with coordinates for d1nl3b4.
(The format of our PDB-style files is described here.)

Timeline for d1nl3b4: