| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (3 species) a pre-protein crosslinking domain inserted in the first AAA domain |
| Species Mycobacterium tuberculosis [TaxId:1773] [89687] (2 PDB entries) |
| Domain d1nl3b3: 1nl3 B:2-225,B:350-396 [85845] Other proteins in same PDB: d1nl3a1, d1nl3a2, d1nl3a5, d1nl3b1, d1nl3b2, d1nl3b5 |
PDB Entry: 1nl3 (more details), 2.8 Å
SCOPe Domain Sequences for d1nl3b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nl3b3 c.37.1.19 (B:2-225,B:350-396) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}
lskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktdefkrrladqknpetldd
llpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktgegktltcvlpaylnala
gngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpderrvaynaditygtnnef
gfdylrdnmahslddlvqrghhyaivdevdsilideartpliisXnqtlatitlqnyfrl
ydklagmtgtaqteaaelheiyklgvvsiptn
Timeline for d1nl3b3: