Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain [418978] (3 species) a pre-protein crosslinking domain inserted in this first AAA domain |
Species Mycobacterium tuberculosis [TaxId:1773] [419444] (2 PDB entries) |
Domain d1nl3b3: 1nl3 B:2-225,B:350-396 [85845] Other proteins in same PDB: d1nl3a1, d1nl3a2, d1nl3a4, d1nl3a5, d1nl3b1, d1nl3b2, d1nl3b4, d1nl3b5 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1nl3 (more details), 2.8 Å
SCOPe Domain Sequences for d1nl3b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nl3b3 c.37.1.19 (B:2-225,B:350-396) Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} lskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktdefkrrladqknpetldd llpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktgegktltcvlpaylnala gngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpderrvaynaditygtnnef gfdylrdnmahslddlvqrghhyaivdevdsilideartpliisXnqtlatitlqnyfrl ydklagmtgtaqteaaelheiyklgvvsiptn
Timeline for d1nl3b3: