Lineage for d1nl3b2 (1nl3 B:616-835)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752608Fold a.172: Helical scaffold and wing domains of SecA [81885] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 1752609Superfamily a.172.1: Helical scaffold and wing domains of SecA [81886] (1 family) (S)
    automatically mapped to Pfam PF07516
  5. 1752610Family a.172.1.1: Helical scaffold and wing domains of SecA [81887] (1 protein)
  6. 1752611Protein Helical scaffold and wing domains of SecA [81888] (3 species)
  7. 1752617Species Mycobacterium tuberculosis [TaxId:1773] [89122] (2 PDB entries)
  8. 1752621Domain d1nl3b2: 1nl3 B:616-835 [85844]
    Other proteins in same PDB: d1nl3a1, d1nl3a3, d1nl3a4, d1nl3b1, d1nl3b3, d1nl3b4

Details for d1nl3b2

PDB Entry: 1nl3 (more details), 2.8 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis in apo form
PDB Compounds: (B:) Preprotein translocase secA 1 subunit

SCOPe Domain Sequences for d1nl3b2:

Sequence, based on SEQRES records: (download)

>d1nl3b2 a.172.1.1 (B:616-835) Helical scaffold and wing domains of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
akmvtraiksaqtqveqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldm
vrdvitayvdgatgegyaedwdldalwtalktlypvgitadsltrkdheferddltreel
leallkdaerayaareaeleeiagegamrqlernvllnvidrkwrehlyemdylkegigl
ramaqrdplveyqregydmfmamldgmkeesvgflfnvtv

Sequence, based on observed residues (ATOM records): (download)

>d1nl3b2 a.172.1.1 (B:616-835) Helical scaffold and wing domains of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
akmvtraiksaqtqveqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldm
vrdvitayvdgatgegyaedwdldalwtalktlypvgitadslteelleallkdaeraya
areaeleeiagegamrqlernvllnvidrkwrehlyemdylkegiglramaqrdplveyq
regydmfmamldgmkeesvgflfnvtv

SCOPe Domain Coordinates for d1nl3b2:

Click to download the PDB-style file with coordinates for d1nl3b2.
(The format of our PDB-style files is described here.)

Timeline for d1nl3b2: