Lineage for d1nl3a4 (1nl3 A:397-615)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870899Protein Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain [418979] (3 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [419445] (2 PDB entries)
  8. 2870908Domain d1nl3a4: 1nl3 A:397-615 [85842]
    Other proteins in same PDB: d1nl3a1, d1nl3a2, d1nl3a3, d1nl3a5, d1nl3b1, d1nl3b2, d1nl3b3, d1nl3b5
    has additional insertions and/or extensions that are not grouped together

Details for d1nl3a4

PDB Entry: 1nl3 (more details), 2.8 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis in apo form
PDB Compounds: (A:) Preprotein translocase secA 1 subunit

SCOPe Domain Sequences for d1nl3a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl3a4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
mpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrrip
hnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpv
etpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgd
pgesrfylslgdelmrrfngaaletlltrlnlpddvpie

SCOPe Domain Coordinates for d1nl3a4:

Click to download the PDB-style file with coordinates for d1nl3a4.
(The format of our PDB-style files is described here.)

Timeline for d1nl3a4: