Lineage for d1nl3a3 (1nl3 A:-15-225,A:350-396)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314510Family c.37.1.19: Tandem AAA-ATPase domain [81268] (6 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 314558Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (2 species)
    a pre-protein crosslinking domain inserted in the first AAA domain
  7. 314564Species Mycobacterium tuberculosis [TaxId:1773] [89687] (2 PDB entries)
  8. 314569Domain d1nl3a3: 1nl3 A:-15-225,A:350-396 [85841]
    Other proteins in same PDB: d1nl3a1, d1nl3a2, d1nl3b1, d1nl3b2

Details for d1nl3a3

PDB Entry: 1nl3 (more details), 2.8 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis in apo form

SCOP Domain Sequences for d1nl3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl3a3 c.37.1.19 (A:-15-225,A:350-396) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis}
dspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktd
efkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktg
egktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpde
rrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdevdsilideartplii
sXnqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgvvsiptn

SCOP Domain Coordinates for d1nl3a3:

Click to download the PDB-style file with coordinates for d1nl3a3.
(The format of our PDB-style files is described here.)

Timeline for d1nl3a3: