SCOPe 2.08: Domain d1nl3a3: 1nl3 A:2-225,A:350-396

Lineage for d1nl3a3 (1nl3 A:2-225,A:350-396)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain [418978] (3 species)
   a pre-protein crosslinking domain inserted in this first AAA domain

7. Species Mycobacterium tuberculosis [TaxId:1773] [419444] (2 PDB entries)

8. Domain d1nl3a3: 1nl3 A:2-225,A:350-396 [85841]
   Other proteins in same PDB: d1nl3a1, d1nl3a2, d1nl3a4, d1nl3a5, d1nl3b1, d1nl3b2, d1nl3b4, d1nl3b5
   has additional insertions and/or extensions that are not grouped together

Details for d1nl3a3

PDB Entry: 1nl3, 2.8 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis in apo form

PDB Compounds: (A:) Preprotein translocase secA 1 subunit

SCOPe Domain Sequences for d1nl3a3:

Sequence; same for both SEQRES and ATOM records:

>d1nl3a3 c.37.1.19 (A:2-225,A:350-396) Translocation ATPase SecA, nucleotide-binding domains, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
lskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktdefkrrladqknpetldd
llpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktgegktltcvlpaylnala
gngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpderrvaynaditygtnnef
gfdylrdnmahslddlvqrghhyaivdevdsilideartpliisXnqtlatitlqnyfrl
ydklagmtgtaqteaaelheiyklgvvsiptn

Timeline for d1nl3a3:

• d1nl3a3 first appeared in SCOP 1.65
  
• d1nl3a3 appears in SCOPe 2.07