| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.162: Pre-protein crosslinking domain of SecA [81766] (1 superfamily) core: 4 helices: bundle; flanked by two short beta-hairpins duplication: consists of two structural repeats |
Superfamily a.162.1: Pre-protein crosslinking domain of SecA [81767] (1 family) ![]() automatically mapped to Pfam PF01043 |
| Family a.162.1.1: Pre-protein crosslinking domain of SecA [81768] (1 protein) |
| Protein Pre-protein crosslinking domain of SecA [81769] (3 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [89058] (2 PDB entries) |
| Domain d1nl3a1: 1nl3 A:226-349 [85839] Other proteins in same PDB: d1nl3a2, d1nl3a3, d1nl3a4, d1nl3a5, d1nl3b2, d1nl3b3, d1nl3b4, d1nl3b5 |
PDB Entry: 1nl3 (more details), 2.8 Å
SCOPe Domain Sequences for d1nl3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nl3a1 a.162.1.1 (A:226-349) Pre-protein crosslinking domain of SecA {Mycobacterium tuberculosis [TaxId: 1773]}
gpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaans
plvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehve
ikae
Timeline for d1nl3a1: