| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (3 species) a pre-protein crosslinking domain inserted in the first AAA domain |
| Species Mycobacterium tuberculosis [TaxId:1773] [89687] (2 PDB entries) |
| Domain d1nktb4: 1nkt B:397-615 [85837] Other proteins in same PDB: d1nkta1, d1nkta2, d1nkta5, d1nktb1, d1nktb2, d1nktb5 complexed with adp, mg |
PDB Entry: 1nkt (more details), 2.6 Å
SCOPe Domain Sequences for d1nktb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nktb4 c.37.1.19 (B:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}
mpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrrip
hnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpv
etpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgd
pgesrfylslgdelmrrfngaaletlltrlnlpddvpie
Timeline for d1nktb4: