Lineage for d1nktb4 (1nkt B:397-615)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989960Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 990133Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (2 species)
    a pre-protein crosslinking domain inserted in the first AAA domain
  7. 990143Species Mycobacterium tuberculosis [TaxId:1773] [89687] (2 PDB entries)
  8. 990147Domain d1nktb4: 1nkt B:397-615 [85837]
    Other proteins in same PDB: d1nkta1, d1nkta2, d1nktb1, d1nktb2
    complexed with adp, mg

Details for d1nktb4

PDB Entry: 1nkt (more details), 2.6 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis complex with adpbs
PDB Compounds: (B:) Preprotein translocase secA 1 subunit

SCOPe Domain Sequences for d1nktb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nktb4 c.37.1.19 (B:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}
mpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrrip
hnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpv
etpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgd
pgesrfylslgdelmrrfngaaletlltrlnlpddvpie

SCOPe Domain Coordinates for d1nktb4:

Click to download the PDB-style file with coordinates for d1nktb4.
(The format of our PDB-style files is described here.)

Timeline for d1nktb4: