Lineage for d1nktb3 (1nkt B:-15-225,B:350-396)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 583265Family c.37.1.19: Tandem AAA-ATPase domain [81268] (13 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 583360Protein Translocation ATPase SecA, nucleotide-binding domains [82414] (2 species)
    a pre-protein crosslinking domain inserted in the first AAA domain
  7. 583370Species Mycobacterium tuberculosis [TaxId:1773] [89687] (2 PDB entries)
  8. 583373Domain d1nktb3: 1nkt B:-15-225,B:350-396 [85836]
    Other proteins in same PDB: d1nkta1, d1nkta2, d1nktb1, d1nktb2

Details for d1nktb3

PDB Entry: 1nkt (more details), 2.6 Å

PDB Description: crystal structure of the seca protein translocation atpase from mycobacterium tuberculosis complex with adpbs

SCOP Domain Sequences for d1nktb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nktb3 c.37.1.19 (B:-15-225,B:350-396) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis}
dspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktd
efkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktg
egktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpde
rrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdevdsilideartplii
sXnqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgvvsiptn

SCOP Domain Coordinates for d1nktb3:

Click to download the PDB-style file with coordinates for d1nktb3.
(The format of our PDB-style files is described here.)

Timeline for d1nktb3: